PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462930561
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family B3
Protein Properties Length: 380aa    MW: 42753.9 Da    PI: 10.2812
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462930561genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B334.24.4e-1122921290
               HTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
         B3 12 ksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90
               +++ l++p + a+e+g++  +  +  l  +++r W vkl  +  +++ +l++GW eF+ a g+ eg  vv+++ g  ++
  462930561 22 THSSLRVPDELAQEIGSD--G--EACLVGPRSRIWHVKL--EHDGDGAFLGRGWPEFAAACGVGEGWLVVLRHRG--NG 92
               567899*********876..3..799*************..999999*************************755..44 PP

2B347.72.9e-15161242996
                HHHHTT-EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
         B3   9 dvlksgrlvlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                ++l++  l+l+k+f+++ +++  ++ t++l++ +++ +W+v   + +k g+y++++GW++F+ +n+Lkeg + +F++   +e +l+v v
  462930561 161 NTLNK-ELSLSKSFCDAVKLQ--GTSTIKLRTsRNNTEWQVSG-HPQKNGSYIIRQGWRRFCLDNNLKEGNISTFHV---KEPTLWVLV 242
                44544.5***********999..45589999956779******.4555567*************************4...445567665 PP

3B346.85.5e-152993731286
                HTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
         B3  12 ksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                + + l+l  +f+e +g+++++ +tl+   +s  sW+v++   k+s+++v + GW+ F k+ng+k gD+++F++++
  462930561 299 AAKTLYLTQSFCEGIGLSEPCIITLKTSMRSVMSWKVRVVPYKNSCHHVSGLGWRMFYKDNGIKLGDVCTFTVIE 373
                34569*************99988888777888*******99*******************************775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010194.3E-517102IPR003340B3 DNA binding domain
SuperFamilySSF1019363.92E-111996IPR015300DNA-binding pseudobarrel domain
CDDcd100172.34E-72292No hitNo description
PfamPF023622.0E-82296IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.1E-102297IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508638.79744102IPR003340B3 DNA binding domain
PROSITE profilePS5086311.801152247IPR003340B3 DNA binding domain
SMARTSM010190.0014154248IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.5E-14159242IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019368.63E-12160245IPR015300DNA-binding pseudobarrel domain
PfamPF023628.2E-13162242IPR003340B3 DNA binding domain
CDDcd100178.62E-9167243No hitNo description
PROSITE profilePS508639.968288380IPR003340B3 DNA binding domain
SMARTSM010190.32290377IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.1E-12292374IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.32E-12295375IPR015300DNA-binding pseudobarrel domain
PfamPF023624.1E-12300373IPR003340B3 DNA binding domain
CDDcd100173.13E-8303375No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MASTGDGGAS KAGDLRLLLP FTHSSLRVPD ELAQEIGSDG EACLVGPRSR IWHVKLEHDG  60
DGAFLGRGWP EFAAACGVGE GWLVVLRHRG NGLLTIKARY LTHSINQNQH NCSSQAAAVP  120
RKAYTRTQES SMVSTKKASS WRKSFYRTVP PFMIRREINA NTLNKELSLS KSFCDAVKLQ  180
GTSTIKLRTS RNNTEWQVSG HPQKNGSYII RQGWRRFCLD NNLKEGNIST FHVKEPTLWV  240
LVIITRSEEY HETPSASSRK RKREYDRSSS MGQRTLLRCV FNSMQPGAWM EKKVDTSTAA  300
KTLYLTQSFC EGIGLSEPCI ITLKTSMRSV MSWKVRVVPY KNSCHHVSGL GWRMFYKDNG  360
IKLGDVCTFT VIERTLWLAV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.13e-14B3 family protein